Übersicht der Preisträgerinnen und Preisträger

Übersicht der Preisträgerinnen und Preisträger

Max-Planck-Medaille

Die Max-Planck-Medaille ist die höchste Auszeichnung der DPG für herausragende Leistungen auf dem Gebiet der theoretischen Physik.

© privat

Prof. Dr. Dieter Vollhardt
Universität Augsburg

„In Würdigung seiner bedeutenden Beiträge zur Ableitung einer neuen Meanfield-Theorie korrelierter Quantensysteme und zum Verständnis von Vielteilchenproblemen in der Quantentheorie kondensierter Materie“

Dieter Vollhardt von der Universität Augsburg erhält die „Max-Planck-Medaille“, die wichtigste Auszeichnung der Deutschen Physikalischen Gesellschaft für theoretische Physik. Der 58-jährige Physikprofessor wird für seine Beiträge zur Festkörperphysik ausgezeichnet. Seine Forschungsergebnisse dienen dem Verständnis der mikroskopischen Vorgänge in magnetischen und „elektronisch korrelierten“ Materialien, wie den Metalloxiden. Neben ihrer Bedeutung für die Grundlagenforschung ist Vollhardts Arbeit auch für Entwicklung neuer Materialien von Interesse. Vollhardts Fachgebiete sind die Theorie des Magnetismus und die Theorie „elektronischer Korrelationen“, die beide auf dem Grundgerüst der Quantentheorie aufbauen. Hinter diesen physikalisch-mathematischen Modellen steht die Frage nach der Ursache von Materialeigenschaften wie der elektrischen Leitfähigkeit oder der Magnetisierbarkeit. Von zentraler Bedeutung sind in diesem Zusammenhang die in einem Festkörper vorhandenen Elektronen, die sich je nach Material nahezu frei bewegen oder auch lokalisiert sein können. Diese Elektronen sind für die thermischen, elektrischen und magnetischen Eigenschaften fester Materialien maßgebend. Die Herausforderung an die theoretische Physik besteht darin, das Zusammenspiel unzähliger Elektronen – pro Kubikzentimeter typischerweise 1022, also zehntausend Trillionen – in geeigneter Weise zu erfassen. Hier setzt Vollhardts Arbeit an. Er entwickelte beispielsweise eine neuartige „Theorie des mittleren Feldes“, die die Wechselwirkungen der Elektronen untereinander – auch „elektronische Korrelationen“ genannt – besser beschreibt als herkömmliche Ansätze, was zu neuen Erkenntnissen im Bereich der Materialwissenschaft geführt hat. Zudem hat Vollhardt entscheidend zur Anwendung und Weiterentwicklung dieser Theorie beigetragen. Auch gelangen ihm Vorhersagen, die durch spätere Experimente bestätigt wurden.

Stern-Gerlach-Medaille

Die Stern-Gerlach-Medaille ist die höchste Auszeichnung der DPG für herausragende Leistungen auf dem Gebiet der experimentellen Physik. Sie wird für Arbeiten aus dem gesamten Bereich der Physik vergeben.

© privat

Prof. Dr. Horst Schmidt-Böcking
Universität Frankfurt

„Die Stern-Gerlach Medaille 2010 wird Herrn Prof. Horst Schmidt-Böcking in Anerkennung seiner bahnbrechenden Leistungen bei der Entwicklung der „Cold Target Recoil Ion Momentum Spectroscopy“ (COLTRIMS)-Methode verliehen. Diese Arbeiten ermöglichten einen völlig neuartigen Einblick in die innere Dynamik von atomaren und molekularen Reaktionen. Die COLTRIMS-Methode und die hieraus hervorgegangenen „Reaktions-Mikroskope“ besitzen in ihrer Anwendung eine enorme Ausstrahlung auch auf viele andere Bereiche der Physik, von der Atom- und Molekülphysik bis hin zur Oberflächenphysik.“

Teilchen unter der Lupe: Horst Schmidt-Böcking von der Universität Frankfurt am Main erhält die „Stern-Gerlach-Medaille“, die wichtigste Auszeichnung der Deutschen Physikalischen Gesellschaft für experimentelle Physik. Der 70-jährige Physikprofessor wird für die die Entwicklung eines Messverfahrens ausgezeichnet, das detaillierte Einblicke in das Innenleben von Atomen und Molekülen liefert. Die COLTRIMS genannte Technik, deren Anfänge in den 1980er Jahren liegen, ermöglicht es, das Auseinanderbrechen von Atomen und Molekülen mit großer Genauigkeit zu vermessen und damit die Bewegungen der beteiligten Elektronen und Atomkerne nachzuweisen. Damit konnten erstmals nicht nur die Energien einzelner Teilchen erfasst, sondern das komplexe Zusammenwirken mehrerer Elektronen und Kerne als Ganzes untersucht werden. Wichtige Naturphänomene, etwa das Knüpfen chemischer Bindungen, beruhen auf dem Zusammenspiel solcher Teilchenbewegungen. Die von Schmidt-Böcking eingeführte Methode kommt insbesondere in der Atom-, der Molekül- und in der Oberflächenphysik zum Einsatz und hat daher Ausstrahlung auf viele Teilgebiete der Physik. Heute zählen COLTRIMS-Apparaturen zur Standardausrüstung von Forschungslabors in aller Welt.

Die Auszeichnung wurde im März 2010 während der DPG-Jahrestagung in Bonn überreicht.

Gentner-Kastler-Preis

Der Gentner-Kastler-Preis wird gemeinsam von der DPG und der Société Française de Physique verliehen. Er wird für besonders wertvolle wissenschaftliche Beiträge zur Physik jährlich abwechselnd einem Physiker / einer Physikerin mit Lebens- und Tätigkeitsmittelpunkt in Deutschland bzw. Frankreich zuerkannt.

© privat

Le Si Dang

Max-Born-Preis

Der Max-Born-Preis wird für besonders wertvolle und aktuelle wissenschaftliche Beiträge zur Physik gemeinsam vom britischen Institute of Physics (IOP) und der DPG in Erinnerung an das Wirken Max Borns in Großbritannien und Deutschland verliehen. Er wird jährlich abwechselnd einem Physiker / einer Physikerin mit Lebens- und Tätigkeitsmittelpunkt in Deutschland bzw. Großbritannien zuerkannt.

© MPI für Astrophysik

Simon White

Herbert-Walther-Preis

Der Herbert-Walther-Preis ehrt herausragende Beiträge in der Quantenoptik und der Atomphysik sowie hervorragende Leistungen in der internationalen wissenschaftlichen Gemeinschaft. Der Preis wird gemeinsam von der Optical Society of America (OSA) und der Deutschen Physikalischen Gesellschaft (DPG) in Erinnerung an Herbert Walther vergeben, der in den USA und in Deutschland mit großem Erfolg geforscht und sich durch sein Wirken für die OSA und DPG in hervorragender Weise verdient gemacht hat. Die Verleihung erfolgt jährlich abwechselnd in den USA und in Deutschland.

© privat

Serge Haroche

„For using the techniques of quantum optics and atomic physics to creatively illuminate the mysterious world near to the quantum classical border, where waves become particles and ordinary physics emerges from the quantum domain.“

Robert-Wichard-Pohl-Preis

Der Robert-Wichard-Pohl-Preis wird für hervorragende Beiträge zur Physik verliehen, die eine besondere Ausstrahlung auf andere Disziplinen in Wissenschaft und Technik haben, für außergewöhnliche Leistungen in der Verbreitung wissenschaftlicher Erkenntnis in der Lehre, im Unterricht und in der Didaktik der Physik.

© privat

Prof. Dr. Ulrich Platt
Universität Heidelberg

„Für seine hervorragenden Verdienste bei der Entwicklung des DOAS-Verfahrens zur atmosphärischen Spektroskopie. Dieses erlaubt die räumlich aufgelöste Messung fast aller für die Atmosphärenchemie relevanten Spurenstoffe mit sehr hoher Genauigkeit. Der Einsatz des DOAS-Verfahrens für die Fernerkundung hat die Entwicklung von Atmosphärenmodellen revolutioniert.“

Erkundung der Atmosphäre: Ulrich Platt von der Universität Heidelberg erhält den mit 5.000 Euro dotierten „Robert-Wichard-Pohl-Preis“ der Deutschen Physikalischen Gesellschaft. Der 60-jährige Umweltphysiker wird für die Entwicklung eines Verfahrens zur Messung atmosphärischer Schadstoffe und Spurengase ausgezeichnet. Die DOAS genannte Technik – das Kürzel steht für „Differentielle Optische Absorptionsspektroskopie“ – wird unter anderem von Satelliten zur Untersuchung der Erdatmosphäre eingesetzt. Dies hat die Entwicklung von Atmosphärenmodellen revolutioniert.

Die Auszeichnung wird im März 2010 während der DPG-Jahrestagung in Hannover überreicht.

Medaille für Naturwissenschaftliche Publizistik

Verliehen von der DPG für publizistische Leistungen, die zur Verbreitung naturwissenschaftlich-physikalischen Denkens im deutschsprachigen Raum in hervorragender Weise beitragen.

© ZDF/Rico Rossival

Hildegard Werth
ZDF

„Die TV-Journalistin Hildegard Werth erhält die „Medaille für Naturwissenschaftliche Publizistik“ der Deutschen Physikalischen Gesellschaft (DPG). Seit über 20 Jahren informiert die ZDF-Reporterin das Fernsehpublikum über Aktuelles aus Medizin, Technik und Naturwissenschaften. Insbesondere Astronomie und Raumfahrt stehen immer wieder im Fokus von Hildegard Werth. Über komplexe Themen berichtet sie sachlich und dennoch in faszinierender Weise. Beispielhaft dafür sind ihre Beiträge für das „heute journal“ und ihre eigene Sendung „WissensWERTH“ im ZDF-Infokanal. “

Die Auszeichnung wird im März 2010 in Dresden überreicht.

Walter-Schottky-Preis

Der Walter-Schottky-Preis dient der Auszeichnung einer in den letzten beiden Jahren, bevorzugt im letzten Jahr, auf dem Gebiet der Festkörperforschung veröffentlichten, hervorragenden Arbeit eines oder mehrerer junger Physiker/innen.

© privat

Thomas Seyller
Universität Erlangen

„Für seinen bedeutenden Beitrag zur Physik des Wachstums von Graphen, insbesondere zur Graphen-Synthese auf Siliziumkarbid.“

Ultradünne Kohlenstoff-Schichten: Thomas Seyller von der Universität Erlangen-Nürnberg erhält den mit 15.000 Euro dotierten „Walter-Schottky-Preis“ der Deutschen Physikalischen Gesellschaft. Der 43-jährige Wissenschaftler wird für die Entwicklung eines Verfahrens zur Herstellung von Graphen ausgezeichnet. Graphen ist ein Material, das aus einer einzigen Lage von Kohlenstoff-Atomen besteht und aufgrund seiner besonderen Merkmale die Phantasie der Fachleute beflügelt.

Die ultradünnen Kohlenstoff-Schichten sind von Interesse für die Grundlagenforschung, weil das zweidimensionale Material ungewöhnliche Eigenschaften aufweist. Zudem wird Graphen als Baustoff für elektronische Schaltkreise gehandelt. Voraussetzung für die Ausschöpfung dieses Potentials ist eine reproduzierbare, gleichmäßige und großflächige Herstellung von Graphen. Hier liegt der bedeutende Beitrag von Thomas Seyller, der ein Verfahren entwickelt hat, mit dem Graphen in höchster Qualität und mit den Standardmethoden der Halbleitertechnik synthetisiert werden kann. Die Methode hat international Aufmerksamkeit erregt: Von US-amerikanischen Forschern wurden bereits Graphen-Transistoren nach dem Seyller’schen Verfahren hergestellt.

Die Auszeichnung wird im März 2010 während der DPG-Tagung in Regensburg überreicht.

Gustav-Hertz-Preis

Der Gustav-Hertz-Preis soll eine hervorragende, kürzlich abgeschlossene Arbeit eines oder mehrerer junger Physiker/innen auszeichnen und so dem Ansporn des Nachwuchses dienen. Dabei soll die auszuzeichnende Arbeit aus den Gebieten der experimentellen oder theoretischen Physik stammen, einen gewissen Abschluss zeigen und neue Erkenntnisse enthalten. "Erkenntnis" wird dabei nicht allein im Sinne der Grundlagen verstanden, sondern es werden auch Ergebnisse im Sinne der Anwendung und Praxis gewertet. Als "junge Physiker/innen" werden auch solche mit abgeschlossener Promotion und in besonderen Fällen mit abgeschlossener Habilitation verstanden, sofern ihnen zum Zeitpunkt des Vorschlags kein Angebot einer Lebensstellung als Hochschullehrer/in oder einer leitenden Stellung in einem hochschulfreien Forschungsinstitut oder in der Industrie vorliegen.

© privat

Dr. Thomas Pohl
MPI Dresden

„Für die theoretische Beschreibung der Formation von Anti-Wasserstoff in hohen Magnetfeldern und der damit verbundenen Schaffung der Grundlage für zukünftige Experimente mit Antiwasserstoff im Grundzustand.“

Die Auszeichnung wird im März 2010 während der DPG-Jahrestagung in Bonn überreicht.

Hertha-Sponer-Preis

Der Hertha-Sponer-Preis wird für hervorragende wissenschaftliche Arbeiten auf dem Gebiet der Physik an eine Wissenschaftlerin vergeben. Der Preis soll vor allem jüngere Wissenschaftlerinnen durch öffentliche Auszeichnung ermutigen und so mehr Frauen für die Physik gewinnen.

© privat

Na Liu
Uni Stuttgart / Univ. of California at Berkeley

„Für ihre wegweisenden Beiträge zur Herstellung und Charakterisierung dreidimensionaler Metallnanostrukturen“

Die Auszeichnung wird im März 2010 während der DPG-Jahrestagung in Regensburg überreicht.

AMOP-Dissertationspreis

Die in der Sektion AMOP zusammengeschlossenen Fachverbände der DPG schreiben einen Dissertationspreis aus. Ziel des Preises ist die Anerkennung herausragender wissenschaftlicher Arbeit und deren exzellenter Darstellung in einem Vortrag.

© privat

Dr. Henning Vahlbruch

„Herr Vahlbruch hat mit seiner Dissertation den Weg bereitet für die erste Anwendung gequetschten Lichts in Gravitationswellendetektoren. Deren Design wird in Zukunft weltweit durch seine Ergebnisse wesentlich geprägt sein.“

Die Auszeichnung wurde im März 2010 auf der DPG-Frühjahrstagung in Hannover verliehen.

SKM-Dissertationspreis

Die in der SKM zusammengeschlossenen Fachverbände der DPG schreiben einen Dissertationspreis aus. Ziel des Preises ist die Anerkennung herausragender wissenschaftlicher Arbeit und deren exzellenter Darstellung in einem Vortrag.

© privat

Dr. Lena Ivanova

„für ihre Dissertation und den Vortrag mit dem Titel "Nitrogen containing III-V semiconductor surfaces and nanostructures studied by scanning tunneling microscopy and spectroscopy“

Die Auszeichnung wurde im März 2010 auf der DPG-Frühjahrstagung in Regensburg verliehen.

© privat

Dr. Michael Wimmer

„für seine Dissertation und den Vortrag mit dem Titel „Quantum transport in nanostructures: from numerical algorithms to spintronics in graphene.“

Die Auszeichnung wurde im März 2010 auf der DPG-Frühjahrstagung in Regensburg verliehen.

SMuK-Dissertationspreis

Die in der SMuK zusammengeschlossenen Fachverbände der DPG schreiben einen Dissertationspreis aus. Ziel des Preises ist die Anerkennung herausragender wissenschaftlicher Arbeit und deren exzellenter Darstellung in einem Vortrag.

© DPG

Dr. Korinna Zapp

„Für ihre Dissertation und den Vortrag mit dem Titel "A Monte Carlo model for jet evolution with energy loss."“

Die Auszeichnung wurde im März 2010 auf der DPG-Frühjahrstagung in Bonn verliehen.

Georg-Simon-Ohm-Preis

Der Georg-Simon-Ohm-Preis soll eine hervorragende, kürzlich abgeschlossene Arbeit eines Studenten oder einer Studentin der physikalischen Technik oder verwandter Studiengänge an Fachhochschulen auszeichnen und so dem Ansporn des physikalisch-technischen Nachwuchses dienen.

© Roswitha Kaster - Die Fotografin

Jan Mathis Kaster
Fachhochschule Aachen

„Für seine Untersuchungen zur Specklereduktion bei der Infrarot-lasergestützten Ferndetektion von Oberflächenkontaminationen“

Die Auszeichnung wird im März 2010 während der DPG-Jahrestagung in Hannover überreicht.

Georg-Kerschensteiner-Preis

Der Georg-Kerschensteiner-Preis kann für hervorragende Leistungen auf folgenden, der Vermittlung der Physik dienenden Gebieten, verliehen werden: a) Lehre im Bereich Schule, Hochschule und Weiterbildung, b) Erforschung der Lehr- und Lernprozesse im Physikunterricht und c) Entwicklung und Erforschung neuer Konzepte und Medien für die Lehre und deren wissenschaftliche Evaluation.

Michael Winkhaus
Carl-Fuhlrott-Gymnasium Wuppertal

„Für die außerordentlich erfolgreiche Heranführung von Schülerinnen und Schülern an astronomische und physikalische Fragestellungen. Ihm gelingt es, Jugendliche nachhaltig zum eigenständigen forschenden Arbeiten durch die Entwicklung und Nutzung von astronomischen Beobachtungsinstrumenten anzuregen. Die von ihm initiierten und betreuten Projekte haben im Rahmen von Wettbewerben überregional große Anerkennung gefunden. Die Verleihung des Kerschensteiner-Preises würdigt die Erfolge seiner begeisternden und zugleich anspruchsvollen Vermittlung moderner physikalischer und astronomischer Erkenntnisse und Verfahren.“

Die Auszeichnung wird im März 2010 während der DPG-Jahrestagung in Hannover überreicht.

Young Scientist Award for Socio- and Econophysics

Der Young Scientist Award for Socio- and Econophysics verfolgt das Ziel, die Arbeit junger Forscherinnen und Forscher zu fördern und herausragende wissenschaftliche Beiträge zu würdigen, die mit aus der Physik stammenden Methoden zu einem besseren Verständnis von sozio-ökonomischen Problemen beitragen.

Prof. Dr. Dirk Brockmann

Schülerinnen- und Schülerpreis (IYPT)

Der Preis wird an Schülerinnen und Schüler für besondere physikalische Leistungen verliehen. Es werden die fünf Teilnehmerinnen und Teilnehmer des deutschen Nationalteams des International Young Physicists' Tournament ausgezeichnet.

© SFZ Südwürttemberg

Marc Burock

Dominik Dold

Lukas Kaiser

Britta Vincon

Simeon Völkel

„Die Verleihung erfolgt in Würdigung der Leistungen, die sie als Mitglied des deutschen Teams beim 22nd International Young Physicists‘ Tournament in Tianjin (China) erbracht haben.“

Schülerinnen- und Schülerpreis (PhysikOlympiade)

Der Preis wird an Schülerinnen und Schüler für besondere physikalische Leistungen verliehen. Er wurde 1982 - 91 von der Physikalischen Gesellschaft der DDR vergeben und von der DPG übernommen. Es werden die fünf besten deutschen Teilnehmerinnen und Teilnehmer der jährlichen PhysikOlympiade ausgezeichnet.

© IPN Kiel

Daniel Brügmann
Carl-Zeiss-Gymnasium, Jena

Pascal Cremer
Gymnasium Korschenbroich

Fabian Gundlach
Gymnasium Neubiberg, Neubibgerg

Martin Krebs
Jack-Steinberger-Gymnasium, Bad Kissingen

Patrick Steinmüller
Carl-Zeiss-Gymnasium, Jena

„Die Verleihung erfolgt in Würdigung der Leistungen, die sie als Mitglied der deutschen Mannschaft bei der 40. Internationalen Physikolympiade in Mérida (Mexiko) erreicht haben.“

Ehrennadel der DPG

Prof. Dr. Walter Blum (verstorben 2013)

„Die DPG vergibt die Ehrennadel für sein hervorstechendes Engagement im Arbeitskreis „Energie“. Seine Beiträge zu den Energiestudien der DPG sowie seine fachkundigen und richtungweisenden Artikel zu Energiethemen in den Physikalischen Blättern und im Physik Journal haben entscheidend zur positiven Sichtbarkeit der DPG in der Energiedebatte beigetragen. “

Prof. Dr. Dr. Siegfried Großmann

„Die DPG zeichnet ihn als langjährigen Kurator der Physikalischen Blätter und des Physik Journals sowie als Vorsitzenden des Kuratoriums des Internetportals „Welt der Physik“ aus. Mit seinen Beiträgen hat er sich große Verdienste für die Lehrerausbildung im Fach Physik und für die Vermittlung physikalischer Zusammenhänge erworben. “

Dr. Irmgard Heber (verstorben 2019)

„Die DPG möchte damit ihren unermüdlichen Einsatz für den Physikunterricht als Leiterin des Arbeitskreises Schule der DPG, als Mitglied der Jury der Wilhelm und Else Heraeus-Stiftung für den Bereich Schülerförderung und im Vorstandsrat der DPG honorieren. Beispielhaft zu nennen ist auch der Physik-Schülerwettbewerb der MNU für Schülerinnen und Schüler der Sekundarstufe I, den sie 1995 ins Leben gerufen hat.“

Prof. Dr. Dieter Hoffmann

„Die DPG würdigt damit seine langjährige Arbeit als Vorsitzender des Fachverbandes Geschichte der Physik und als Berater des Archivs der DPG, mit der er maßgeblich das geschichtliche Bewusstsein der DPG gestärkt hat. Besondere Beachtung fanden die Studie „Zwischen Autonomie und Anpassung, die DPG im Dritten Reich“, zahlreiche Aufsätze zu den bedeutendsten deutschen Physikern und die Vorbereitung und Durchführung des Einsteinjahres 2005. “

Dr. Bernd Kretschmer

„Die Auszeichnung wird vergeben für sein außerordentliches Engagement in der Förderung von begabten Schülerinnen und Schülern im Bereich der Physik. Darunter fällt die Betreuung des Deutschen Teams beim „International Young Physicists‘ Tournament“ und die Initiierung des Schülerforschungszentrum im Lörrach-Dreiländereck „Phaenovum“.“

StD Rudolf Lehn

„Die Auszeichnung wird vergeben für seine besondere Initiative bei der Begabtenförderung im Bereich der Physik. Er ist Gründer des ersten deutschen Schülerforschungszentrums, das inzwischen zahlreiche Preisträger in internationalen Wettbewerben hervorgebracht hat und eine Kaderschmiede für das Deutsche Team beim „International Young Physicists‘ Tournament“ ist.“

Dr. Monika Mattern-Klosson

„Die DPG dankt ihr für ihr besonderes Engagement durch ihre langjährigere Mitgliedschaft im Arbeitskreis Industrie und Wirtschaft sowie für ihre Vorstandsmitgliedschaft. Dadurch ist es gelungen, die Attraktivität der DPG für Industriephysiker deutlich zu steigern und die Verbindung der Industriephysiker zur DPG nachhaltig zu verbessern.“

Prof. Dr. Heiner Müller-Krumbhaar

„Die DPG honoriert damit sein Engagement für die Physik in der Schule und als langjähriger Vorsitzender des Fachverbandes Dynamik und Statistische Physik. Er war Mitorganisator des „Jahres der Physik 2000“ und im Lenkungsausschuss von „Welt der Physik“, wodurch er wesentlich zur Stärkung des Ansehens der DPG beigetragen hat.“

Prof. Dr. Gerd Röpke

„Die DPG ehrt mit der Verleihung seine herausragenden Verdienste als Präsident der Physikalischen Gesellschaft der DDR bei der Vereinigung der beiden physikalischen Fachgesellschaften in Ost- und Westdeutschland im Zuge der Deutschen Wiedervereinigung. Besonders ausgezeichnet wird ferner sein langjähriges großes Engagement im Vorstand der DPG und im Kuratorium des Magnus-Hauses Berlin.“

Dr. Barbara Sandow

„Die DPG zeichnet Frau Sandow für ihr unermüdliches Engagement für Frauen in der Physik aus. Zu ihren Leistungen zählen die Etablierung der Physikerinnentagung, die Einführung der Lise-Meitner-Lectures und die „Role Model“-Ausstellung, mit der junge Frauen motiviert werden, Physik zu studieren.“

Prof. Dr. Ludwig Schultz

„Die DPG erkennt damit seine wissenschaftlichen Leistungen auf dem Gebiet der Halbleiterphysik an, die zu einer Reihe erfolgreicher Publikationen geführt haben. Als regelmäßiger Organisator der Frühjahrstagung der Sektion Kondensierte Materie und langjähriger Vorsitzender des Fachverbandes Metall- und Materialphysik sowie des Arbeitskreises Festkörperphysik hat er die DPG wesentlich mitgestaltet.“

Kurt Seelmann

„Die DPG möchte damit ihre Dankbarkeit für sein hervorragendes ehrenamtliches Engagement als Vorsitzender des Kuratoriums des Physikzentrums Bad Honnef, als Vorsitzender des Verwaltungsrats und des Bauausschusses zum Ausdruck bringen. Hervorheben möchte die DPG insbesondere auch sein außerordentlich hilfreiches Wirken bei der Förderung des Physikzentrums durch das Land NRW.“

Dr. Hermann-Friedrich Wagner

„Die DPG würdigt damit einen langjährigen Förderer der physikalischen Grundlagenforschung und Initiator der „Highlights der Physik“. Durch sein stetiges Engagement im Lenkungsausschuss und Kuratorium von „Welt der Physik“ sowie im Kuratorium des Magnus Hauses in Berlin hat er sich bleibende Verdienste erworben.“

Prof. Dr. Eberhard Wassermann (verstorben 2020)

„Die DPG würdigt damit sein langjähriges Engagement als Vorsitzender des Fachverbandes Magnetismus. Durch sein besonderes Engagement für die „Highlights der Physik“ sowie seine unermüdliche Arbeit im Kuratorium von „Welt der Physik“ hat er dazu beigetragen, die physikalische Forschung einer breiten Öffentlichkeit zugänglich zu machen.“

Prof. Dr. Manuela Welzel-Breuer

„Die DPG verleiht die Ehrennadel für ihren unermüdlichen Einsatz in ihrem Amt als Vorstandsmitglied für den Bereich Schule, durch den es ihr gelungen ist, den Physikunterricht als eine wichtige Zukunftsaufgabe in den Fokus der DPG zu rücken. Sie ist die Initiatorin und Ideengeberin des Fortbildungsnetzwerkes „fobinet“ der DPG.“