Übersicht der Preisträgerinnen und Preisträger

Übersicht der Preisträgerinnen und Preisträger

Max-Planck-Medaille

Die Max-Planck-Medaille ist die höchste Auszeichnung der DPG für herausragende Leistungen auf dem Gebiet der theoretischen Physik.

Prof. Dr. Jürgen Ehlers
Max-Planck-Institut für Gravitationsphysik, Albert-Einstein-Institut, Golm

„In Würdigung seiner bedeutenden und grundlegenden Beiträge zur Allgemeinen Relativitätstheorie, zur Kosmologie und zur allgemein relativistischen Kinetischen Theorie und Hydrodynamik.“

Stern-Gerlach-Medaille

Die Stern-Gerlach-Medaille ist die höchste Auszeichnung der DPG für herausragende Leistungen auf dem Gebiet der experimentellen Physik. Sie wird für Arbeiten aus dem gesamten Bereich der Physik vergeben.

Prof. Dr. Jan Peter Toennies
Max-Planck-Institut für Strömungsforschung, Göttingen

„In Würdigung seiner herausragenden und international wegweisenden Arbeiten auf den Gebieten der Oberflächen- und Clusterphysik, insbesondere zur Streuung von Helium-Atomstrahlen an Oberflächen, und zur Spektroskopie an Helium-Nanotröpfchen.“

Die Auszeichnung wurde im März 2002 während der DPG-Frühjahrstagung in Leipzig überreicht.

Gentner-Kastler-Preis

Der Gentner-Kastler-Preis wird gemeinsam von der DPG und der Société Française de Physique verliehen. Er wird für besonders wertvolle wissenschaftliche Beiträge zur Physik jährlich abwechselnd einem Physiker / einer Physikerin mit Lebens- und Tätigkeitsmittelpunkt in Deutschland bzw. Frankreich zuerkannt.

Jean-Marie Flaud

Max-Born-Preis

Der Max-Born-Preis wird für besonders wertvolle und aktuelle wissenschaftliche Beiträge zur Physik gemeinsam vom britischen Institute of Physics (IOP) und der DPG in Erinnerung an das Wirken Max Borns in Großbritannien und Deutschland verliehen. Er wird jährlich abwechselnd einem Physiker / einer Physikerin mit Lebens- und Tätigkeitsmittelpunkt in Deutschland bzw. Großbritannien zuerkannt.

Prof. Dr. Siegfried Dietrich

Robert-Wichard-Pohl-Preis

Der Robert-Wichard-Pohl-Preis wird für hervorragende Beiträge zur Physik verliehen, die eine besondere Ausstrahlung auf andere Disziplinen in Wissenschaft und Technik haben, für außergewöhnliche Leistungen in der Verbreitung wissenschaftlicher Erkenntnis in der Lehre, im Unterricht und in der Didaktik der Physik.

Hanns Ruder (verstorben am 17.10.2015)

„In Würdigung seiner herausragenden Verdienste um die didaktische Vermittlung komplexer physikalischer Probleme, insbesondere aus der Astrophysik.“

Die Auszeichnung wurde im März 2002 in Leipzig überreicht.

Medaille für Naturwissenschaftliche Publizistik

Verliehen von der DPG für publizistische Leistungen, die zur Verbreitung naturwissenschaftlich-physikalischen Denkens im deutschsprachigen Raum in hervorragender Weise beitragen.

Ranga Yogeshwar

Walter-Schottky-Preis

Der Walter-Schottky-Preis dient der Auszeichnung einer in den letzten beiden Jahren, bevorzugt im letzten Jahr, auf dem Gebiet der Festkörperforschung veröffentlichten, hervorragenden Arbeit eines oder mehrerer junger Physiker/innen.

Dr. Harald Reichert
Max-Planck-Institut für Metallforschung Stuttgart

„Für die Entdeckung der lokalen fünfzähligen Symmetrie in Flüssigkeiten durch Röntgenbeugung in der Nähe einer Festkörperoberfläche.“

Die Auszeichnung wurde im März 2002 während der DPG-Frühjahrstagung in Regensburg überreicht.

Gaede-Preis

Der Gaede-Preis, 1985 von Dr. Manfred Dunkel gestiftet, wird durch die Gaede-Stiftung finanziert und von der Deutschen Physikalischen Gesellschaft e.V. (DPG) vergeben. Seit 2017 zählt der Gaede-Preis zu den genuinen DPG-Preisen. Der Preis wird in der Regel auf der DPG-Frühjahrstagung der Sektion Kondensierte Materie (SKM) überreicht. Die Auszeichnung besteht aus einem Preisgeld von bis zu 10.000 Euro, einem durch Leybold gestifteten Modell der ersten Molekularluftpumpe von Prof. Wolfgang Gaede und einer Urkunde.

Priv.-Doz. Dr. Christian Teichert

„In Würdigung seiner wegweisenden Arbeiten zum Verständnis von Selbstorganisations-Phänomenen auf der Nanometerskala in der Halbleiter-Heteroepitaxie und des Einsatzes von selbstorganisierten Halbleiteroberflächen als Substrate für magnetische Nanostrukturen.“

Gustav-Hertz-Preis

Der Gustav-Hertz-Preis soll eine hervorragende, kürzlich abgeschlossene Arbeit eines oder mehrerer junger Physiker/innen auszeichnen und so dem Ansporn des Nachwuchses dienen. Dabei soll die auszuzeichnende Arbeit aus den Gebieten der experimentellen oder theoretischen Physik stammen, einen gewissen Abschluss zeigen und neue Erkenntnisse enthalten. "Erkenntnis" wird dabei nicht allein im Sinne der Grundlagen verstanden, sondern es werden auch Ergebnisse im Sinne der Anwendung und Praxis gewertet. Als "junge Physiker/innen" werden auch solche mit abgeschlossener Promotion und in besonderen Fällen mit abgeschlossener Habilitation verstanden, sofern ihnen zum Zeitpunkt des Vorschlags kein Angebot einer Lebensstellung als Hochschullehrer/in oder einer leitenden Stellung in einem hochschulfreien Forschungsinstitut oder in der Industrie vorliegen.

Prof. Dr. Michael Bonitz

„Mit der Preisverleihung werden die herausragenden Arbeiten von Herrn Dr. Michael Bonitz über Coulombkorrelationseffekte in Plasmen, in optisch angeregten Halbleitern und in niederdimensionalen Systemen gewürdigt. Herr Bonitz hat wichtige Beiträge zur Quantenkinetik geleistet und darüber hinaus Computersimulationen entwickelt, mit denen er viel beachtete Ergebnisse zur Wignerkristallisation entarteter mesoskopischer Elektronencluster erzielt hat. Durch seine fächerübergreifenden wissenschaftliche Arbeiten hat Herr Bonitz erfolgreich nationale und internationale Kooperationen befruchtet.“

Die Auszeichnung wurde im März 2002 während der Physikertagung in Leipzig überreicht.

Hertha-Sponer-Preis

Der Hertha-Sponer-Preis wird für hervorragende wissenschaftliche Arbeiten auf dem Gebiet der Physik an eine Wissenschaftlerin vergeben. Der Preis soll vor allem jüngere Wissenschaftlerinnen durch öffentliche Auszeichnung ermutigen und so mehr Frauen für die Physik gewinnen.

Prof. Dr. Karina Morgenstern
Freie Universität Berlin

„Für ihre fundamentalen Beiträge zum Verständnis der Wachstumsdynamik von Nanostrukturen auf technischen Oberflächen. “

Die Auszeichnung wird im März 2002 während der DPG-Jahrestagung in Leipzig überreicht.

Georg-Simon-Ohm-Preis

Der Georg-Simon-Ohm-Preis soll eine hervorragende, kürzlich abgeschlossene Arbeit eines Studenten oder einer Studentin der physikalischen Technik oder verwandter Studiengänge an Fachhochschulen auszeichnen und so dem Ansporn des physikalisch-technischen Nachwuchses dienen.

Dipl.-Phys. Thomas Zentgraf

Young Scientist Award for Socio- and Econophysics

Der Young Scientist Award for Socio- and Econophysics verfolgt das Ziel, die Arbeit junger Forscherinnen und Forscher zu fördern und herausragende wissenschaftliche Beiträge zu würdigen, die mit aus der Physik stammenden Methoden zu einem besseren Verständnis von sozio-ökonomischen Problemen beitragen.

Damien Challet

Schülerinnen- und Schülerpreis (IYPT)

Der Preis wird an Schülerinnen und Schüler für besondere physikalische Leistungen verliehen. Es werden die fünf Teilnehmerinnen und Teilnehmer des deutschen Nationalteams des International Young Physicists' Tournament ausgezeichnet.

Bernd Kaifler

Patrick Kerner

Anja Sutter

Bastian Tomczyk

Matthias Tröndle

Schülerinnen- und Schülerpreis (PhysikOlympiade)

Der Preis wird an Schülerinnen und Schüler für besondere physikalische Leistungen verliehen. Er wurde 1982 - 91 von der Physikalischen Gesellschaft der DDR vergeben und von der DPG übernommen. Es werden die fünf besten deutschen Teilnehmerinnen und Teilnehmer der jährlichen PhysikOlympiade ausgezeichnet.

Tobias Fritz

Sebastian Höppner

Alexander Köhler

Stefan Meinel

Stefan Pauliuk