DPG
Mitgliedschaft
Veranstaltungen
Programme
Preise
Veröffentlichungen
Presse
Service
 
Druckversion
Position: www.dpg-physik.de  >  preise  >  preistraeger2011.html

Preisträgerinnen und Preisträger 2011

Max-Planck-Medaille 2011

höchste DPG-Auszeichnung für Theoretische Physik

Professor Giorgio Parisi)
Università di Roma „La Sapienza“ (Italien)


„für seine bedeutenden Beiträge in der theoretischen Elementarteilchenphysik und Quantenfeldtheorie und der Statistischen Physik, insbesondere von Systemen mit eingefrorener Unordnung, vor allem Spingläser“

Bild: Università di Roma

Teilchen, Quanten und Statistik: Der Italiener Giorgo Parisi erhält die „Max-Planck-Medaille“, die höchste Auszeichnung der Deutschen Physikalischen Gesellschaft für Theoretische Physik, für seine richtungsweisenden Beiträge zur Physik komplexer Systeme. Die Forschungsschwerpunkte des 62-jährigen Physikprofessors, der an der Universität Rom arbeitet, umfassen die Elementarteilchenphysik, die Statistische Physik und die „Quantenfeldtheorie“, die mikroskopische Phänomene auf Grundlage der Quantenphysik beschreibt.

Die Auszeichnung ist undotiert und besteht aus einer Goldmedaille, die im März 2011 während der DPG-Jahrestagung in Dresden überreicht wird.


Stern-Gerlach-Medaille 2011

höchste DPG-Auszeichnung für Experimentelle Physik

Prof. Dr. Günter Wolf
Deutsches Elektronen-Synchrotron DESY, Hamburg


„für seine herausragende Rolle bei der Konzeption und Durchführung von Experimenten zur Streuung von Elektronen an Positronen und an Protonen, die unter anderem zur Entdeckung des Gluons, dem Feldquant der starken Wechselwirkung, führten. Seine Entdeckungen haben das Verständnis der fundamentalen Bausteine der Materie entscheidend geprägt. Über viele Jahrzehnte hat Herr Professor Wolf durch seine wegweisende Ideen Schlüsselexperimente der Teilchenphysik initiiert und zum Erfolg geführt. Seine Urteilsfähigkeit und seine Leistungen als Wissenschaftler machen ihn zu einer international hochgeschätzten Persönlichkeit, die für viele junge Physiker zum Vorbild geworden ist.“

Bild: DESY

Klebstoff der Kernmaterie: Der Hamburger Teilchenphysiker Günter Wolf erhält die „Stern-Gerlach-Medaille“, die höchste Auszeichnung der Deutschen Physikalischen Gesellschaft für Experimentelle Physik. Der 73-jährige Wissenschaftler hat mit seiner Tätigkeit am Deutschen Elektronen-Synchrotron DESY die Entwicklung der Teilchenphysik nachhaltig geprägt. Insbesondere war Wolf an der Entdeckung des „Gluons“ maßgeblich beteiligt. Dieses Elementarteilchen überträgt das zwischen den kleinsten Materiebausteinen – den „Quarks“ – wirkende Kraftfeld. Fachleute sprechen in diesem Zusammenhang von der „Starken Wechselwirkung“. Indirekt sorgt das Gluon auch für die Stabilität von Atomkernen; es ist gewissermaßen der Klebstoff, der die Kernmaterie und damit die Welt im Innersten zusammenhält.

Das Gluon ist ein wichtiger Baustein im Theoriegebäude der Teilchenphysik. Die Entdeckung des Gluons gilt daher als herausragendste Leistung in der rund 50-jährigen Geschichte des Forschungszentrums DESY.

Die Auszeichnung ist undotiert und besteht aus einer Goldmedaille, die im März 2011 während der DPG-Jahrestagung in Dresden überreicht wird.


Gustav-Hertz-Preis 2011

fur junge Physikerinnen und Physiker

Dr. Jörn Dunkel
University of Cambridge (UK)


„in Anerkennung seiner bahnbrechenden Arbeiten zur Statistischen Physik, insbesondere zur Vereinheitlichung von Spezieller Relativitätstheorie und Thermodynamik“

Bild: privat

Tempo und Temperatur: Jörn Dunkel von der Universität Cambridge erhält den mit 7.500 Euro dotierten „Gustav-Hertz-Preis“ der Deutschen Physikalischen Gesellschaft. Der 34-jährige theoretische Physiker wird in Würdigung seiner richtungsweisenden Arbeiten zur Statistischen Physik, insbesondere zur relativistischen Brown’schen Bewegung und der relativistischen Thermodynamik ausgezeichnet.

Im Fokus von Dunkels Arbeiten steht insbesondere ein Thema, das seit über 100 Jahren kontrovers diskutiert wird. Persönlichkeiten wie Albert Einstein und Max Planck versuchten sich an dieser Aufgabe, gelangten aber zu widersprüchlichen Ergebnissen. Es geht darum, ob ein bewegtes Objekt gegenüber einem ruhenden Beobachter kühler oder heißer erscheint als im Ruhezustand. Auf den Punkt gebracht: Ist die Temperatur abhängig von der Bewegung? Vor dieser Frage stehen Forscher beispielsweise, wollen sie die Verhältnisse in einem extrem heißen Plasma beschreiben. Ein „Plasma“ ist ein gasähnliches Gemisch aus elektrisch geladenen Teilchen. In sehr heißen Plasmen bewegen sich die Teilchen nahezu mit Lichtgeschwindigkeit. Unter irdischen Verhältnissen sind derlei Bedingungen ungewöhnlich, sie finden sich allerdings bei Plasmen im Weltraum.

Es gelang Dunkel, die Widersprüche in den Resultaten seine berühmten Vorgänger aufzulösen und zu zeigen, dass die Temperatur eines bewegten Objekts in allen Bezugssystemen gleich ist.

Die Auszeichnung wird im März 2011 während der DPG-Jahrestagung in Dresden überreicht


Robert-Wichard-Pohl-Preis 2011

für Beiträge zur Physik von interdisziplinärer Bedeutung

Dr. Gerhard Meyer
IBM Forschungslaboratorium Rüschlikon (Schweiz)


„für seine bahnbrechenden Forschungsarbeiten auf dem Gebiet der Rastersondenmikroskopie und -spektroskopie. Seine Experimente ermöglichen die Veranschaulichung chemischer Prozesse. Die Arbeiten umfassen die Abbildung von Molekülorbitalen und die gezielte Manipulationen auf atomarer Skala. Seine eindrucksvollen Ergebnisse stellen einen weiteren Schritt dar, die Welt der Atome begreifbarer zu machen, und haben inzwischen Eingang in Standardlehrbücher gefunden.“

Bild: IBM Research - Zurich

Einblicke in die Nanowelt: Gerhard Meyer vom IBM Forschungslaboratorium Rüschlikon erhält den mit 5.000 Euro dotierten „Robert-Wichard-Pohl-Preis“ der Deutschen Physikalischen Gesellschaft für seine Arbeiten über atomare und molekulare Prozesse auf Festkörperoberflächen. Während des letzten Jahrzehnts hat der 54-jährige Nanowissenschaftler eine Serie von herausragenden Experimenten mit Hilfe der „Rastersondenmikroskopie“ durchgeführt. Ihm ist es dabei gelungen, Atome und Moleküle mit noch nie dagewesener Präzision nicht nur sichtbar zu machen, sondern auch zu beeinflussen. Die daraus gewonnenen Erkenntnisse könnten Ansatzpunkt sein für neuartige, nur Nanometer große elektronische Bauteile.

Herzstück der Rastersondenmikroskopie ist ein winziger Messfühler, mit dem die Probenoberfläche abgetastet wird. Auf diese Weise konnte der Nanoforscher erstmals eine chemische Reaktion von einzelnen Molekülen in Gang setzen. Überdies greift Meyer auf einen besonderen Trick zurück: Am Messfühler des Mikroskops befestigt er ein einziges Molekül, das dann als eigentliche Sonde dient. Dieser Kunstgriff steigert einerseits die Empfindlichkeit des Mikroskops und eröffnet andererseits neue Experimentiermöglichkeiten. Es gelang ihm so die „Anatomie“, also die chemische Struktur eines Moleküls, in all ihren Feinheiten abzubilden und atomare „Schaltvorgänge“ zu beobachten, bei denen die Atome ihre Position innerhalb eines Moleküls verändern.

Meyers Arbeiten begeistern Physiker, Chemiker und Biologen gleichermaßen. Ergebnis seiner Forschung sind faszinierende Aufnahmen von Atomen und Molekülen, die Lehrbücher illustrieren und die Nanowelt sichtbar machen.

Die Auszeichnung wird im März 2011 während der DPG-Jahrestagung in Dresden überreicht


Herbert-Walther-Preis 2011

deutsch-amerikanische Auszeichnung für Beiträge zur Quantenoptik und Atomphysik

Professor Marlan O. Scully
Princeton University und Texas A&M University (USA)


„für seine bahnbrechenden Arbeiten, mit denen er die theoretischen Grundlagen für das Gebiet der Quantenoptik gelegt hat.“

Bild: Princeton University

Licht und Materie: Der US-Amerikaner Marlan O. Scully erhält den deutsch-amerikanischen „Herbert-Walther-Preis“, der mit 5.000 Euro dotiert ist. Der 71-jährige Physikprofessor ist ein weltweit geschätzter Experte auf dem Gebiet der Quantenoptik, der die Erforschung des Zusammenspiels von Licht und Materie maßgeblich mitgestaltet. Er gilt als eine Schlüsselfigur bei der Entwicklung der ersten Beschreibung des Lasers auf Grundlage der Quantentheorie. Wichtige Beiträge leistete er auch zur Theorie des „Freien-Elektronen-Lasers“, er erdachte so erstaunliche Dinge wie den Laser ohne Besetzungs-Inversion und zeigte Wege auf, um das eigentlich rasante Licht abzubremsen und sogar komplett zum Stillstand zu bringen.

Doch nicht nur die Theorie, auch experimentelle Untersuchungen gehören zu Scullys Wirkungskreis. Seiner Arbeitsgruppe gelang es beispielsweise Giftgase und bakterielle Sporen des Anthrax-Erregers per Laser-Spektroskopie nachzuweisen, was das Potential dieser Methode für die Sicherheitstechnik demonstriert.

Die Auszeichnung wird gemeinsam von der Optical Society of America und der Deutschen Physikalischen Gesellschaft verliehen.


Hertha-Sponer-Preis 2011

für Physikerinnen

Dr. Martina Hentschel
Max-Planck-Institut für Physik komplexer Systeme, Dresden


„für ihre herausragenden theoretischen Arbeiten zu mesoskopischen elektronischen und optischen Systemen, insbesondere zu optischen Mikrokavitäten. Die Resultate ihrer Untersuchungen zur Abstrahlcharakteristik von Mikrolasern wurden experimentell eindrucksvoll bestätigt.“

Bild: privat

Laser im Miniformat: Martina Hentschel vom Dresdner Max-Planck-Institut für Physik komplexer Systeme erhält den mit 3.000 Euro dotierten „Hertha-Sponer-Preis“ der Deutschen Physikalischen Gesellschaft. Forschungsschwerpunkt der 39-jährigen Wissenschaftlerin ist die theoretische Beschreibung mesoskopischer elektronischer und optischer Systeme. Ihre Arbeiten sind für die Entwicklung miniaturisierter Laser von praktischer Bedeutung.

Mesoskopische Systeme sind klein aber nicht zu klein. Sie liegen gewissermaßen zwischen Quanten- und Makrowelt. Ein Beispiel dafür sind optische „Mikrokavitäten“, auch optische „Mikroresonatoren“ genannt. Solche nur Mikrometer große Strukturen können als miniaturisierte Laser verwendet werden, sofern sie das Licht gebündelt in eine Richtung abstrahlen – was eine besondere Herausforderung darstellt. Hentschel hat verschiedene Ansätze zur Realisierung derartiger Laser aufgezeigt. Binnen weniger Monate hatten experimentelle Arbeitsgruppen ihre Gedanken aufgegriffen, solche Mikrolaser hergestellt und ihre Vorhersagen damit eindrucksvoll bestätigt.

Die Auszeichnung wird im März 2011 während der DPG-Jahrestagung in Dresden überreicht


Georg-Kerschensteiner-Preis 2011

für Beiträge zur Didaktik und Schulphysik

StD Ernst Leitner und StD Uli Finckh
beide Physik-Lehrer im Ruhestand, ehemals Rupprecht-Gymnasium, München


„für die Konzeption und Bereitstellung eines neuartigen Multimedia-Lernsystems (LEIFI), das im Internet verfügbar ist. Es enthält in systematischer, nach Jahrgängen und Sachbereichen geordneter Form Aufgaben, Experimente, bewegte Darstellungen und Simulationen, die in hervorragender Weise zum eigenständigen Lernen hinführen. Um Nachhaltigkeit zu gewährleisten, wird das Material ständig an wissenschaftliche und curriculare Veränderungen angepasst. Der große Erfolg des Systems beruht darauf, dass Schülerinnen und Schüler zu selbständigem Erkunden der Teilbereiche der Physik angeregt werden und dass Lehrkräften ein Vorrat an Aufgabenstellungen zur Verfügung steht, der an den Interessen der Jugendlichen und an den Erfordernissen der Lehrpläne orientiert ist.“

Die Preisträger Ernst Leitner und Uli Finckh, Bild: privat

Multimediale Physik: Zwei pensionierte Gymnasiallehrer aus Bayern teilen sich den mit 3.000 Euro dotierten „Georg-Kerschensteiner-Preis“ der Deutschen Physikalischen Gesellschaft. Ernst Leitner (München) und Uli Finckh (Herrsching/Breitbrunn am Ammersee, Bayern), die ehemals am Münchener Rupprecht-Gymnasium Physik unterrichteten, werden für die Konzeption und Bereitstellung des Multimedia-Lernsystems LEIFI ausgezeichnet. LEIFI, das vor rund 10 Jahren aus der Taufe gehoben wurde, ist zum Selbstkostenpreis auf CD erhältlich und im Internet unter www.leifiphysik.de verfügbar.

LEIFI ist aus einer Aufgabenkartei für Schülerinnen und Schüler hervorgegangen und enthält in systematischer, nach Jahrgängen und Sachbereichen geordneter Form physikalische Aufgaben, Experimente, bewegte Darstellungen und Animationen, Videofilme und Simulationen, die in hervorragender Weise zum eigenständigen Lernen hinführen. Das Material wird weiterhin ständig an wissenschaftliche und curriculare Veränderungen angepasst, etwa an die Verkürzung der gymnasialen Schulzeit auf acht Jahre.

Die Auszeichnung wird im März 2011 während der DPG-Jahrestagung in Dresden überreicht


Max-Born-Preis 2011

deutsch-britische Auszeichnung

Professor David Philip Woodruff
University of Warwick, Department of Physics (UK)


„for his pioneering work in the development of experimental techniques for quantitative surface structure determination and their use in providing new insights into a range of surface phenomena“

Bild: University of Warwick

Oberflächenphänomene: Der Physiker David Philip Woodruff von der Universität Warwick erhält den deutsch-britischen „Max-Born-Preis“, der mit 3.000 Euro dotiert ist. Der 66-jährige Wissenschaftler hat zur Aufklärung der atomaren Vorgänge auf Metall- und anderen Festkörperoberflächen maßgeblich beigetragen. Insbesondere wird er für die Entwicklung von vielfältigen Techniken zur Oberflächenanalyse geehrt, die inzwischen in zahlreichen Labors zum Standard geworden sind.

Diese Auszeichnung wird gemeinsam von der Deutschen Physikalischen Gesellschaft und dem britischen Institute of Physics im jährlichen Wechsel an Physikerinnen und Physiker verliehen, die in Deutschland beziehungsweise in Großbritannien arbeiten.

Die Auszeichnung wird im März 2011 während der DPG-Jahrestagung in Dresden überreicht


Marian-Smoluchowski-Emil-Warburg-Preis 2011

deutsch-polnische Auszeichnung

Prof. Dr. Peter Fulde, Emeritus
Max-Planck-Institut für Physik komplexer Systeme, Dresden


„in Anerkennung seiner herausragenden Beiträge zur Theorie der kondensierten Materie. Gewürdigt werden sollen insbesondere die Arbeiten zur Wechselwirkung von Supraleitung und Magnetismus, zum Einfluss lokaler Anregungen auf elektronische Eigenschaften und zur Theorie korrelierter Elektronen.“

Bild: MPI für Physik komplexer Systeme

Theorie der Festkörperphysik: Der Dresdner Physiker Peter Fulde, emeritierte Direktor des Max-Planck-Instituts für Physik komplexer Systeme, erhält den deutsch-polnischen „Marian-Smoluchowski-Emil-Warburg-Preis“, der mit 3.000 Euro dotiert ist. Der 74-Jährige wird für seine Beiträge zur Theorie der Festkörperphysik ausgezeichnet. Peter Fulde hat insbesondere zur Erforschung der Supraleitung, des Magnetismus und zum Verständnis „elektronischer Korrelationen“ maßgeblich beigetragen.

Über viele Jahre hinweg hat Peter Fulde enge Verbindungen zu polnischen Wissenschaftlern gepflegt. Von besonderer Bedeutung sind für ihn die freundschaftlichen Beziehungen zu Physikern seiner Heimatstadt Wroclaw (Breslau). Für seine Verdienste wurde er bereits mit einer Ehrenprofessur des „Institute for Low Temperature Physics and Structure Research“ (Polish Academy of Sciences) in Wroclaw ausgezeichnet.

Der „Marian-Smoluchowski-Emil-Warburg-Preis“ wird gemeinsam von der Deutschen Physikalischen Gesellschaft und der Polnischen Physikalischen Gesellschaft alle zwei Jahre an Physikerinnen und Physiker verliehen, die in Deutschland beziehungsweise in Polen tätig sind.


Gentner-Kastler-Preis 2011

deutsch-französische Auszeichnung

Prof. Dr. Georg Maret, Universität Konstanz

für seine herausragenden Arbeiten über „weiche Materialien“

Bild: privat

Forschungsschwerpunkt des Konstanzer Experimentalphysikers sind „weiche Materialien“. Dazu zählen insbesondere Kolloid-Suspensionen und biologische Makromoleküle. Marets Arbeiten legten die Grundlage für eine inzwischen gängige Methode, um solche Materialien zu charakterisieren: die „Diffusing Wave Spectroscopy“. In der Begründung des Preiskomitees heißt es: „für seine Entdeckungen über Lichtstreuung in ungeordneten Medien und seine Beiträge zur Untersuchung der Kristallisation in zwei Dimensionen. Georg Maret entdeckte Interferenzeffekte von mehrfach gestreutem Licht, mit denen die schwache und starke Lokalisierung von Wellen untersucht werden kann und die die Grundlage für die Methode der ‚Diffusing Wave Spectroscopy‘ legten. Seine Präzisionsmessungen an kolloidalen Dispersionen legten das reichhaltige Szenario der Kristallisation und des Schmelzens in zwei Dimensionen offen.“ Georg Maret studierte Physik in Bonn und an der Technischen Universität München. Er promovierte am „High Magnetic Field Laboratory“ im französischen Grenoble und wurde später Direktor des „Institut Charles Sadron“ in Strasbourg. Seit 1997 ist er Professor für Experimentalphysik in Konstanz.

Der „Gentner-Kastler-Preis“ wird gemeinsam von der Deutschen Physikalischen Gesellschaft und der Französischen Physikalischen Gesellschaft im jährlichen Wechsel an in Deutschland beziehungsweise in Frankreich tätige Physikerinnen und Physiker verliehen.
 


Georg-Simon-Ohm-Preis 2011

für physikalische Technik

Cornelia Schultz, Diplom-Ingenieurin für physikalische Technik (FH)
Università di Padova, vorher Hochschule München und Max-Planck-Institut für Physik


„für ihre Entwicklung einer Messmethode zur Bestimmung der optischen Spiegelparameter eines Cherenkov-Teleskopes und für ihre Untersuchungen zur optischen Crosstalkrate von Silizium Photomultipliern“

Bild: privat

„Feinschliff“ für Teleskope: Die Physik-Ingenieurin Cornelia Schultz erhält den mit 1.500 Euro dotierten „Georg-Simon-Ohm-Preis“ der Deutschen Physikalischen Gesellschaft. Die 28-Jährige entwickelte im Rahmen ihrer Diplomarbeit neue Verfahren, um die Messgenauigkeit des auf der kanarischen Insel La Palma gelegenen Cherenkov-Teleskops MAGIC zu testen und zu verbessern. Cherenkov-Teleskope dienen dem Nachweis kosmischer Gamma-Strahlung, wie sie beispielsweise von Schwarzen Löchern emittiert wird.

Cornelia Schultz ist Absolventin der Hochschule München (FH). Für ihre Diplomarbeit, die am Münchener Max-Planck-Institut für Physik entstand, untersuchte sie zwei wichtige Paramater des MAGIC-Teleskops: die optische Qualität der Teleskopspiegel und die Empfindlichkeit der Lichtdetektoren. Inzwischen arbeitet Schultz an der Universität im italienischen Padua an ihrer Doktorarbeit.

Die Auszeichnung wird im März 2011 während der DPG-Jahrestagung in Dresden überreicht.
 


Otto-Hahn-Preis

Gemeinsamer Preis der Stadt Frankfurt am Main, der GDCh (im Zusammenwirken mit dem Deutschen Zentralausschuss für Chemie e. V.) und der DPG.

Manfred Reetz
Direktor der Abteilung für Organische Synthese am Max-Planck-Institut für Kohlenforschung in Mülheim/Ruhr


Bild: MPI f. für Kohlenforschung

Der mit 50.000 Euro dotierte und gemeinsam von der Stadt Frankfurt, der Gesellschaft Deutscher Chemiker (GDCh) und der Deutschen Physikalischen Gesellschaft (DPG) getragene Otto-Hahn-Preis wurde in diesem Jahr in der Frankfurter Paulskirche an Professor Dr. Manfred Reetz, Direktor der Abteilung für Organische Synthese am Max-Planck-Institut für Kohlenforschung in Mülheim/Ruhr, verliehen. Reetz gilt wegen seiner zahlreichen wichtigen Entwicklungen, die er in vielen Teilbereichen der Organischen Chemie anstieß, als einer der bedeutendsten deutschen Chemiker unserer Zeit und als international führender Vertreter des Fachs Organische Chemie. Herausragend sind seine Arbeiten insbesondere auf dem Gebiet der Katalyse. Er ist eine Forscherpersönlichkeit mit breitesten Interessen und unbändiger wissenschaftlicher Neugierde, ein wissenschaftlicher Visionär und zudem ein engagierter Mentor des wissenschaftlichen Nachwuchses.

Seit einigen Jahren befasst sich Reetz damit, die Molekularbiologie in die synthetische organische Chemie einzubringen; sein Arbeitsgebiet wird als „Chemische Evolution im Reagenzglas“ bezeichnet. Einen solchen indirekten evolutionären Ansatz für die organische Synthese zu erschließen, entspricht einem sensationellen Paradigmenwechsel im chemischen Denken. So hat er u.a. molekulare Mutationstechniken und statistische Suchverfahren für die In-vitro-Evolution von neuartigen enantioselektiven Enzymen entwickelt. Mit diesen hocheffizienten Katalysatoren gelingt es, organische Synthesen mit ausgezeichneter Selektivität und Ausbeute durchzuführen. So lassen sich mit Hilfe von enantioselektiven Enzymen Verbindungen gleicher Zusammensetzung, deren Strukturen sich aber wie Bild und Spiegelbild zueinander verhalten („Enantiomere“), nicht als Gemisch, sondern sortenrein erzeugen. Dies ist von enormer physiologischer und pharmakologischer Bedeutung, da jeweils nur eines der Enantiomere die gewünschte Wirkung entfaltet. Eine signifikante Erhöhung der katalytischen Aktivität gegenüber natürlichen Enzymen erzielte er auch durch deren Immobilisierung auf Trägermaterialien.

Als sehr bedeutend gelten auch jüngste Arbeiten von Reetz zur enzymatisch katalysierten Methan-Oxidation. Cytochrom-P450-Enzyme (CYP) können die Kohlenstoff-Wasserstoff-Bindung langkettiger Alkane unter Bildung der entsprechenden Alkohole oxidieren, doch versagen diese Enzyme bei kleinen Alkan-Molekülen, vor allem bei dem kleinsten, dem Methan. Als Hauptbestandteil von Erd- und Biogas wird Methan auch als Ausgangsstoff für Methanol hoch gehandelt. Diesem kleinsten Vertreter der Alkohole wird als chemischem Speichermedium in der derzeitigen Energiediskussion ein höchster Stellenwert beigemessen. Es gelang Reetz und seinen Mitarbeiter nun, CYP-Enzyme so zu modifizieren, dass sie in der Lage sind, die äußerst stabile Kohlenstoff-Wasserstoff-Bindung in Methan zu „knacken“. Dieses „CYP-Tuning“ könnte also einen neuen, vielversprechenden Weg zur Methan-Oxidation eröffnen.

Bereits seit längerem beschäftigt sich Reetz mit der homogenen Katalyse. Seine Arbeiten haben ihn auch hier zu neuen Katalysatorsystemen geführt, beispielsweise zu Monophosphiten für die asymmetrische Hydrierung. Für die Anwendung in der Katalyse und in den Materialwissenschaften studierte Reetz auch nanostrukturierte Metallcluster, wobei er Lösungen fand, diese Partikel in Größe und Form zu kontrollieren. Auch auf einem weiteren modernen Forschungsgebiet ist Reetz tätig: der Supramolekularen Chemie und der molekularen Erkennung. Zahlreiche seiner früheren Arbeiten gehören heute zum Standardrepertoire der Organischen Synthesechemie. Die Dimethylierung von Ketonen ist als „Reetz-Reaktion“ bekannt.

Reetz wurde 1943 in Hirschberg/Schlesien geboren. Ab 1952 lebte er in den USA, wo er auch sein Chemiestudium an der Washington University in St. Louis sowie an der University of Michigan in Ann Arbor absolvierte. An der Universität Göttingen wurde er promoviert, in Marburg habilitierte er sich. 1978 wurde er als C3-Professor an die Universität Bonn, 1980 als C4-Professor an die Universität Marburg und 1991 schließlich als Direktor ans Max-Planck-Institut für Kohlenforschung nach Mülheim berufen. Reetz hat bereits zahlreiche hochrangige Auszeichnungen und Preise erhalten, so den Otto-Bayer-Preis, den Leibniz-Preis der Deutschen Forschungsgemeinschaft, die Hans Herloff Inhoffen Medaille, den Karl-Ziegler-Preis, die Prelog Medaille und den Arthur C. Cope Award. Er ist Mitglied der Deutschen Akademie der Naturforscher Leopoldina (2007 bis 2011 Senator der Gesamtsektion Chemie), war langjähriges Mitglied des GDCh-Vorstands und 1995 GDCh-Vizepräsident.


Medaille für Naturwissenschaftliche Publizistik

Verliehen von der DPG für publizistische Leistungen, die zur Verbreitung naturwissenschaftlich-physikalischen Denkens im deutschsprachigen Raum in hervorragender Weise beitragen.

Günter Paul

Die Deutsche Physikalische Gesellschaft verleiht Herrn Dr. Günter Paul die Medaille für Naturwissenschaftliche Publizistik für sein herausragendes Lebenswerk im Dienste des Wissenschaftsjournalismus in den Druckmedien. Er hat es dabei in beispielhafter Weise verstanden, wissenschaftliche Korrektheit mit anregender Lesbarkeit seiner Artikel und seiner Bücher zu verbinden. Damit hat er es einer großen Leserschaft ermöglicht, an den neuesten Entwicklungen der Naturwissenschaften, namentlich der Physik und der Astronomie, Anteil zu nehmen.

Bild: DPG

Die undotierte Auszeichnung beinhaltet eine Silbermedaille, die im November 2011 während des "Tag der DPG" überreicht wurde.
Weitere Informationen


Schülerinnen- und Schülerpreis der DPG 2011

für herausragende Leistungen bei internationalen Physik-Wettbewerben

Dieser Preis wird in zwei Kategorien verliehen und geht an insgesamt zehn Schülerinnen und Schüler, die jeweils 500 Euro Preisgeld erhalten. Darunter sind auch Jugendliche, die ihre Schulzeit inzwischen abgeschlossen haben. Die Auszeichnung wird im März 2011 während der DPG-Jahrestagung in Dresden überreicht.

Internationale Physikolympiade

Die Preisträger von links nach rechts (Bild: IPN Kiel):

Marcel Ernst, Gymnasium Sulingen (Niedersachsen, Kreis Diepholz)
Fabian Gundlach, Gymnasium Neubiberg (Bayern, Kreis München)
Simon Buchholz , Pestalozzi-Gymnasium Unna (Nordrhein-Westfalen)
Andreas Völklein, Albertus-Magnus-Gymnasium (Regensburg, Bayern)
Johannes Rothe, Werdenfels-Gymnasium, Garmisch-Partenkirchen (Bayern)

„Die Verleihung erfolgt in Würdigung der Leistungen, die sie als Mitglied der deutschen Mannschaft bei der 41. Internationalen Physikolympiade in Zagreb (Kroatien) erreicht haben.“

Physik als olympische Disziplin: Der „Schülerinnen- und Schülerpreis der Deutschen Physikalischen Gesellschaft“ geht an fünf Jugendliche aus Bayern, Niedersachsen und Nordrhein-Westfalen für ihre erfolgreiche Teilnahme an der 41. Internationalen Physikolympiade. Bei diesem Wettbewerb, der im Juli 2010 in der kroatischen Hauptstadt Zagreb stattfand, gewannen alle deutschen Teilnehmer eine Medaille:

Marcel Ernst vom Gymnasium Sulingen in Niedersachsen holte eine Bronzemedaille, Johannes Rothe vom Werdenfels-Gymnasium in bayerischen Garmisch-Partenkirchen errang eine Silbermedaille. Jeweils eine Goldmedaille gewannen Fabian Gundlach (Gymnasium Neubiberg, Bayern), Simon Buchholz (Pestalozzi-Gymnasium Unna, Nordrhein-Westfalen) und Andreas Völklein (Albertus-Magnus-Gymnasium, Regensburg, Bayern).

Die Internationale Physikolympiade ist ein jährlich stattfindender Einzelwettbewerb, der eine theoretische Klausur und eine Prüfung mit experimentellen Aufgaben umfasst. In diesem Jahr mussten sich die Teilnehmer unter anderem mit magnetischen Kräften und dem Gastransport im Innern eines Schornsteins befassen.

An der diesjährigen Physikolympiade beteiligten sich 367 Schülerinnen und Schülern aus 79 Nationen. Fabian Gundlach aus dem bayerischen Neubiberg schloss als drittbester Teilnehmer ab, während Deutschland in der inoffiziellen Mannschaftswertung Platz 5 belegte.

Betreuer der Gruppe waren Dr. Stefan Petersen vom Kieler Leibniz-Institut für die Pädagogik der Naturwissenschaften (IPN) und Axel Boeltzig, ein ehemaliger Teilnehmer des deutschen Vorentscheids zur Physikolympiade.
 

International Young Physicists' Tournament

Die Preisträger von links nach rechts (Bild: SFZ Südwürttemberg):

Björn Miksch , Friedrich-Schiller-Gymnasium, Marbach am Neckar (Baden-Württemberg, Kreis Ludwigsburg)
Ilka Vinçon , Gymnasium Schramberg (Baden-Württemberg, Kreis Rottweil)
Marc Burock , Hohenlohe Gymnasium, Öhringen (Baden-Württemberg, Hohenlohekreis)
Stefan Vierke , Hans-Thoma-Gymnasium, Lörrach (Baden-Württemberg)
Simeon Völkel, Augustinus-Gymnasium, Weiden in der Oberpfalz (Bayern)

„Die Verleihung erfolgt in Würdigung der Leistungen, die sie als Mitglied des deutschen Teams beim 23rd International Young Physicists’ Tournament in Wien (Österreich) erreicht haben.“

Forschung im Teamverband: Der „Schülerinnen- und Schülerpreis der Deutschen Physikalischen Gesellschaft“ geht an fünf Jugendliche aus Bayern und Baden-Württemberg. Beim diesjährigen „Physik-Weltcup“, der im Juli 2010 in Wien stattfand, belegten sie den mit einer Silbermedaille honorierten fünften Platz. Teams aus 25 Ländern hatten sich am Wettbewerb beteiligt.

Das International Young Physicists' Tournament – so die offizielle Bezeichnung des Wettbewerbs – ist im Unterschied zur Physikolympiade ein Mannschaftsturnier. Dessen Aufgabenspektrum umfasst 17 physikalische Fragestellungen, die rund ein halbes Jahr vor dem Turnierstart bekannt gegeben und dann von den Teilnehmern bearbeitet werden. In diesem Jahr mussten die Teilnehmer zum Beispiel herausfinden, warum man auf trockenem Sand weicher läuft als auf feuchtem, und wieso nasse Handtücher Knackgeräusche von sich geben können, wenn man sie wie eine Peitsche schwingt.

Die Aufgaben sind jedes Jahr anspruchsvoll, Lösungen „von der Stange“ gibt es nicht. Während der monatelangen Vorbereitung entstehen somit regelrechte Forschungsprojekte, deren Ergebnisse beim Turnier vorgestellt werden. Austragungsort war diesmal die Technische Universität Wien. Hier diskutierten die Kontrahenten ihre Schlussfolgerungen miteinander und vor den Augen einer Fachjury. Wettkampfsprache bei diesen „Physics Fights“ ist Englisch. Insofern mussten die Nachwuchsforscher neben fachlichem Know-how auch sprachliches Geschick beweisen.

Betreut wurde das deutsche Team von zwei Förderzentren, die seit vielen Jahren junge Talente unterstützen: dem Schülerforschungszentrum Südwürttemberg in Bad Saulgau und dem Phænovum, Schülerforschungsnetzwerk Dreiländereck, in Lörrach.



Dissertationspreis der Sektion Atome, Moleküle, Quantenoptik und Plasmen der DPG (Sektion-AMOP)

Die in der Sektion AMOP zusammengeschlossenen Fachverbände der DPG schreiben einen Dissertationspreis aus. Ziel des Preises ist die Anerkennung herausragender wissenschaftlicher Arbeit und deren exzellenter Darstellung in einem Vortrag.

Christian Groß


Der SAMOP-Dissertations-Preis 2011 geht an Dr. Christian Groß in Würdigung seiner Dissertation, die sich mit folgendem Thema beschäftigt:
In der Quanten-Metrologie wird untersucht, wie mithilfe verschränkter Quantenzustände die Präzision von Messgeräten – insbesondere von Interferometern – über die „klassische“ Schrotrausch-Grenze gesteigert werden kann. Im Labor haben wir gequetschte Zustände, eine spezielle Art von Verschränkung, im Bose-Einstein Kondensat erzeugt und mit diesen ein nichtlineares Atominterferometer realisiert, welches die „klassische” Messgrenze um 15 % übertrifft. Die Charakterisierung des Quantenzustandes im Interferometer zeigt, dass Vielteilchen-Verschränkung von 170 Atomen für diese Verbesserung verantwortlich ist.


Bild: privat

Dissertationspreis der Sektion kondensierte Materie (SKM)

Die in der SKM zusammengeschlossenen Fachverbände der DPG schreiben einen Dissertationspreis aus. Ziel des Preises ist die Anerkennung herausragender wissenschaftlicher Arbeit und deren exzellenter Darstellung in einem Vortrag.

Mathias Kolle


Der SKM-Dissertations-Preis 2011 geht an Dr. Mathias Kolle in Würdigung seiner Dissertation mit dem Titel „Photonic structures inspired by nature“.
In seiner Dissertation untersuchte Herr Kolle natürliche strukturelle Farben und bio-inspirierte photonische Strukturen. In Zusammenarbeit mit Biologen zeigte er, dass verschiedene blühende Pflanzen beugungsgitterähnliche Strukturen auf ihren Blütenblättern besitzen und die resultierenden richtungsabhängigen Farben von Bienen wahrgenommen werden. Darüber hinaus konnte er die Bedeutung biophotonischer Strukturen zur Kontrolle der Reflexion und Beugung von Licht identifizieren. Dazu untersuchte er verschiedene Materialsysteme zur Erzeugung von Multilagenstrukturen zur Nachahmung natürlicher photonischer Systeme.


Bild: privat

Dissertationspreis der Fachverbände Gravitation und Relativitätstheorie, Physik der Hadronen und Kerne, Teilchenphysik

Die genannten Fachverbände der DPG schreiben einen Dissertationspreis aus. Ziel des Preises ist die Anerkennung herausragender wissenschaftlicher Arbeit und deren exzellenter Darstellung in einem Vortrag.

Sebastian Klein


Herr Dr. Sebastian Klein erhält den Dissertationspreis der Fachverbände der Deutschen Physikalischen Gesellschaft Gravitations und Relativitätstheorie, Hadronen und Kerne sowie Teilchenphysik für seine Doktorarbeit "Mellin Moments of Heavy Flavor Contributions to F_2(x,Q2) at NNLO".
Dr. Sebastian Klein hat in seiner Arbeit die Beträge schwerer Quarks zur Strukturfunktion F_2 mit bisher unerreichter Präzision berechnet. Die Produktion schwerer Quarks ist nicht nur bei HERA sondern auch am Tevatron und LHC in nicht allen Details verstanden. Dr. Sebastian Kleins Arbeit ist deshalb nicht nur von höchster technischer Komplexität sondern auch phänomenologisch außerordentlich relevant.


Bild: privat


Eva Hackmann


Frau Dr. Eva Hackmann erhält den Dissertationspreis der Fachverbände der Deutschen Physikalischen Gesellschaft Gravitations und Relativitätstheorie, Hadronen und Kerne sowie Teilchenphysik für ihre Doktorarbeit "Geodesic equations in black hole space-times with cosmological constant".
Frau Dr. Hackmann hat als Erste die Geodätengleichung für eine große Klasse von physikalisch relevanten Gravitationsfeldern analytisch gelöst. Hierzu zählt inbesondere der Fall der Kerr-de- Sitter-Metrik, die ein rotierendes Schwarzes Loch in einem Universum mit Komoslogischer Konstant beschreibt. Damit lassen sich Effekte wie Periheldrehung und Thirring-Lense-Effekt berechnen.


Bild: DESY




Weitere Informationen über die Preise der DPG ...
 
© Deutsche Physikalische Gesellschaft | letzte Änderung 26.02.2014, 13:33 | Impressum | Datenschutz | Kontakt | Bearbeiten